DPCstruct | MC27832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 92 ± 16 aa |
| Standard deviation of domain lengths | 16.01 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 86.54 |
| Assigned Pfam label(s) | CL0123- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0V3X5 | 1-105 | MFEIGDKVFVKNFGGGVITNIQEKNVNGIRKKYYEIKLVIDNICIYLPIDEKNKIRGVIERSKLEDCLKILKEFKGDLPNKCIDRYK… |
| M3HBD2 | 193-286 | KRKTRFKKQNSKALQSFIDLKEGDYVVHIHHGVGKFLKIERTSAGGKERDFLKLEYSGGDSLFVPLDQISLVQRYIGGTESPRLDSL… |
| A0A7V2HXU7 | 248-316 | None |
| A0A1V4G469 | 2-73 | None |
| A0A540VK97 | 524-603 | None |
| A0A7C7EBQ9 | 2-98 | None |
| A0A1V1PG41 | 1-114 | None |
| A0A3A1VQN2 | 186-291 | None |
| A0A379UN59 | 2-71 | None |
| A0A0B8P5T0 | 153-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.