DPCstruct | MC27831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3FVL8 | 1-113 | MKLWPIFKYQKDREGNLVWNVLSLFPVKSEVIDRIWDPLWSLVEYQKLSNGEKRFSVLMRAYSQRWTETEFHASIPFVLELSITPEK… |
| A0A2P2DXE6 | 56-169 | YWKVWPIVRYHKDSEGNTSWNTVSLIPVRFESMEDMWEPIFSIIEYKKLVNGEKRLHLISRLYTQRWTESEFNLHIPLLAEYKKSEK… |
| A0A356KTN4 | 713-812 | None |
| A0A2D5XPN9 | 348-487 | None |
| A0A0S8FXQ1 | 68-187 | None |
| A0A7V1P3H8 | 335-446 | None |
| A0A349H0C7 | 320-453 | None |
| A0A848B354 | 556-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.