DPCstruct | MC27828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1ULG9 | 164-267 | WIGESPYEYLTAPEHEAEMIANVGWDVLDELRNTMIIGSQEMIVEGNWIVGSGCQPHMCNTDFAAMALHRGSGNFIAAIKRDGVVPR… |
| A0A2S0MB27 | 48-176 | PAPVVPPAPASANRAPIDWAALQNAVGSYNAQTQFLRQPGINRRLRALLGVQYELVMRDLQVAGPLQQDKGVYYVTGNQAHKGGVEA… |
| I1DSV4 | 3-122 | None |
| A0A379N969 | 1-152 | None |
| A0A7W9VFG3 | 4-117 | None |
| A0A1X1EW12 | 3-97 | None |
| A0A2D9XPX0 | 188-299 | None |
| K4KGX3 | 36-158 | None |
| A0A072CWF2 | 7-139 | None |
| A0A1J4RQ13 | 208-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.