DPCstruct | MC27821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 117 ± 16 aa |
| Standard deviation of domain lengths | 15.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2HEI3 | 522-607 | LPLKAHSLFELFADPNSDTPFIVNGPDGYAITSIEEARAHQDIMMGAFFDHDLIQSLCQKHGLSFRNRIRIGADGMALIEGRRSSP |
| A0A2G4T050 | 2-116 | ASFSTMRVDAPSLFSLLNHAKSNNLLPLRDSDNFVIGSQDQARHHKDSVFTSIFDLEAVFSICKQPGLAFAQNITSLPGAKSVEMLG… |
| A0A197JD83 | 157-267 | None |
| S2JQV1 | 88-218 | None |
| A0A367KUN7 | 163-265 | None |
| A0A1X0RXW6 | 428-564 | None |
| A0A0B7N0S8 | 53-182 | None |
| A0A0B7MWV9 | 99-205 | None |
| A0A162THD6 | 265-366 | None |
| A0A0B7MVS2 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.