DPCstruct | MC27819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 79 ± 17 aa |
| Standard deviation of domain lengths | 16.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4SJS4 | 3-65 | ISWKLAICMYYYAEYTEENVKKYTEEIKRLGDVEICYNIDPKQPIIVTKERIRKMPNSYQLYP |
| A0A2G4SVK1 | 22-100 | KIMVFISRNHTLCIYYQLKFNEENSIQALEKFQAISDEHEVCYLTDSTIPVFVLKARLYGSSFLFKEYFNEEVPKENVS |
| A0A1X2GHW9 | 2-59 | None |
| A0A1X2GIH6 | 1-61 | None |
| A0A1X2HE02 | 1-115 | None |
| A0A1X2I192 | 1-81 | None |
| A0A1X2I329 | 39-110 | None |
| A0A1X2IL22 | 90-160 | None |
| A0A0B7NBK3 | 3-76 | None |
| A0A168MBG3 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.