DPCstruct | MC27818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4SUK4 | 1-91 | MLRLVYYASSTYVSYKALPLALVIVTKGFSSTAFRREFTIISNGSLLEASCAFWAKQCLLLSADSKVGHLNQTTLDPMVALGHLITS… |
| A0A367JM07 | 73-172 | SPILVEVQCDINEDFIARLVSYSLQLKQEYGQLPKVLVISIKSITTEVKSKFKNLENNCMYTMNCDFWAEICQIISAESIQTHLNKN… |
| A0A0B7N3B8 | 2-100 | None |
| A0A367KFU9 | 59-161 | None |
| I1BU61 | 189-275 | None |
| I1BJF6 | 107-210 | None |
| A0A162Y716 | 6-94 | None |
| A0A0B7N026 | 23-131 | None |
| A0A2G4STV9 | 58-160 | None |
| A0A1X0R1Z5 | 98-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.