DPCstruct | MC27817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448X6Z1 | 2-78 | SDVIKCSVCLDKTSKYKCPRCYTQTCSLECCLLHKDRAHCTGKRDVTEYVRKDEYRYRHFISDYRLLEEIDRANASR |
| A0A2G4SSI5 | 1-91 | MNSSLDPSANGQTSKECEICHAADWKYTCPRCLIHTCSVPCVKKHKLDTQCSGERDKTAYVPLKSYNESTMMNDYTYLEDVSRQSDN… |
| L1LC22 | 3-82 | None |
| A0A7R8XAG0 | 1-91 | None |
| A0A2N9IPF9 | 1-90 | None |
| A0A165A5I2 | 1-95 | None |
| A0A1A8YG79 | 233-346 | None |
| D7U7Z4 | 17-128 | None |
| A0A7M3RJT0 | 89-188 | None |
| S3D1H2 | 10-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.