DPCstruct | MC27816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 428 ± 46 aa |
| Standard deviation of domain lengths | 46.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.07 |
| Pfam Score | 74.21 |
| Assigned Pfam label(s) | PF13821- CL0361- PF12066- CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4SK73 | 1-360 | MMNPQLAWARFPMDPNQLDYLVPYKQFYEYTKRTSNRRIDDEDVQKRYSHYKEKFAARQLSQFFSANKDKQWFLEKYHPTHSRARYE… |
| A0A6G1SFV1 | 6-373 | HQRPYVGGGPIAKKPRMGPRGPPHMMPGHHPEDDNKRLMSFKEFILAQSNDINEQEALARYSEYKTGFTRKRIDDFFKEHQEEEWFR… |
| M7NPM7 | 2-409 | None |
| A0A397H1L0 | 1-488 | None |
| A0A316YN29 | 66-493 | None |
| M2VT22 | 33-517 | None |
| A0A0D2W1M6 | 273-740 | None |
| A0A835ZJR1 | 1-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.