DPCstruct | MC27815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 151 ± 19 aa |
| Standard deviation of domain lengths | 18.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G4SJY5 | 82-247 | SGQLDKGVRNAKCRMTRQLRSQFHHPTTYYLCRASSDATLLSHLQPYTVFTYCDYEGSTKLMDNENASMIASRLFQQIAYSIIHSPS… |
| A0A168M5V6 | 196-337 | IIYQIRQLQSKFDHHSAYQLTRASGPLTRSHKCHPYSVFTLADHDASRTSVALLFRSIALLVLERGSAASLDKSVVQQYAMSSTGKN… |
| A0A1C7MGP7 | 36-183 | None |
| A0A068SDF4 | 232-373 | None |
| I1C417 | 318-472 | None |
| I1BHJ7 | 12-176 | None |
| A0A1Y2GTV7 | 380-536 | None |
| A0A1X0S751 | 347-499 | None |
| A0A1X0RJP4 | 1-156 | None |
| A0A0B7N2E0 | 28-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.