DPCstruct | MC27814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 12.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5WAM1 | 1-118 | MKKKLVVAILLLWANALFADQAAWISKDKAEMAVALLKNIKEVRHFCAPCGDNFYKVEVVSSVQSQKATSEGNFYVVKLNGSEIDLA… |
| A0A2G2DEM7 | 1-121 | MNRLLTILFLAISTLSFADQLSYISKADADQAIAKIEKMKSIYLFCGCCSMTEPVKVNPIKVYAVFTGYEEYWEVYVQYLDEDGITR… |
| A0A7C4KSV8 | 10-150 | None |
| A0A132HZG4 | 1-118 | None |
| A0A7Y7AE26 | 3-148 | None |
| A0A1V5KKR3 | 13-151 | None |
| A0A524M6X5 | 14-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.