DPCstruct | MC27812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8WUL9 | 193-268 | NDDEAPKVLDSNGTELQSGDSVTLIKDLKVKGAGVTLKRGTVIKNIRIDPHNPDEFDCSTKQVKGLVLRTEFVKKV |
| A0A2H0L577 | 2-66 | VVKDSNGNQLNDGDSVSVIKDLSPKGAPTIKRGTKVKIRLTDNEEEVEGKVNGSMMVLRVEFLKK |
| A0A4R3RG58 | 1-75 | None |
| F4L3P0 | 16-96 | None |
| A0A1R4EN58 | 4-88 | None |
| A0A3D3GF03 | 89-164 | None |
| A0A655RKD9 | 74-147 | None |
| A0A2X2J0V8 | 54-124 | None |
| A0A1M7YNX6 | 3-74 | None |
| A0A7Z8FZ19 | 56-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.