DPCstruct | MC27810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 116 ± 20 aa |
| Standard deviation of domain lengths | 19.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C9IN09 | 40-153 | WNKTVRFSPEDTGTLIGLPYRYTVPSMNDSFQEMYYWDTFFTGEGLIADGYGDLAQSNVENMLYMVERYGKMLNGNRTFFENRSQPP… |
| A0A7R8WRI6 | 105-214 | WKKLGKKVVDDVRDNPSQYSILYVPHPTIVPGGRFREFYYWDSYWTIRGLLVSGMTDTVKGMLLNFLALVERFGFVPNGGRIYYSQR… |
| A0A5J5S2I5 | 130-234 | None |
| A0A2M7RBI3 | 6-136 | None |
| A0A7J6LXT6 | 673-783 | None |
| A0A482VSF9 | 182-329 | None |
| A0A0G4HKB5 | 166-335 | None |
| A0A3N4JHL0 | 205-336 | None |
| A0A3Q0IZ97 | 196-327 | None |
| A0A397JK76 | 23-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.