DPCstruct | MC2781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 346 ± 21 aa |
| Standard deviation of domain lengths | 21.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0UFY7 | 3-390 | PCFQDIHRFKIEDLVVWTPDFDEKLPIVDEKLNLKLDLRWEPWSCCSACCCSAITCGPGFDTSEAACRETPSFKSRRGFISFFKNDP… |
| A0A2G5VTF6 | 21-363 | PDDSDEKIFIYQDYESLQVTVGAVKGEQLELFVLWENWGCCSACCCPPAICGHDFQTSSDCENVFSSRTRTGYLSIRLLKKGLKSNQ… |
| K7H0Z5 | 185-520 | None |
| A0A044RR76 | 455-810 | None |
| A0A0M3HUW9 | 140-454 | None |
| A0A085MJI4 | 330-695 | None |
| A0A1I7RHM3 | 205-560 | None |
| A0A1I7XNC8 | 250-581 | None |
| A0A7I4XVN6 | 321-670 | None |
| A0A1I7UT00 | 105-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.