DPCstruct | MC27809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.24 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF18127- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A321LU06 | 54-133 | GAVVKEQDVIEAREFVDQHIGPGVFNFNGWMHIVKHYGGRLPVIIKAVPEGTQVDTHNVLMTIENTDPQCFWLTNYLETL |
| A0A7R8WQW1 | 9-89 | IEQAEKFFSRHLRTSTLFNSDGWKHILEAHDGYLPLRIKAVPEGTIVPTRNVLFTVENTDPKVPWLTGYVEVKNAKKKQVQ |
| A0A4Q3P4V8 | 13-87 | None |
| A0A6A5DIY2 | 204-281 | None |
| A0A813VLD6 | 60-136 | None |
| A0A4Z2B2T5 | 40-117 | None |
| A0A0N4V6K6 | 62-142 | None |
| A0A519Z7N9 | 87-165 | None |
| A0A812KQY6 | 41-138 | None |
| A0A812XSE7 | 727-821 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.