DPCstruct | MC27808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 211 ± 40 aa |
| Standard deviation of domain lengths | 39.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 35.65 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | CL0237- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8ZMG6 | 2-143 | HDLGKVLLLPSFGELPQWAVVGDTYPVGCAFDESIVHHKYFTLNPDYNNSAYNTKYGVYSEGCGLENVLMSWGHDDYMYLVAKENGT… |
| A0A7R8WK73 | 34-259 | IAEDKIQTRVRRLYSLQHQNQTVEFVKQKRLEWLKFDKMEAGLLEALDMLDSYVDESDPDVDHPNIVHGYQTAEAIRAKRPDDDWLQ… |
| A0A822DS31 | 2-160 | None |
| A0A7J6UG90 | 7-212 | None |
| A0A5B8MGR3 | 124-371 | None |
| A0A1I8F3T3 | 555-785 | None |
| A0A2T6ZPK4 | 53-295 | None |
| C4JJ08 | 57-245 | None |
| A0A6D2I6L6 | 4-193 | None |
| A0A7S3ZSA0 | 760-1001 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.