DPCstruct | MC27806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 636 ± 145 aa |
| Standard deviation of domain lengths | 144.80 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 80.13 |
| Assigned Pfam label(s) | PF19292- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182K421 | 8-456 | PAKGTATDLVVQIVLIAESMRLQAMMATYGIQTQTPHEVEPVQIWSSTQLINVYQQLGVNDKIGLTGRPPRPVGSLGTSKVYRICGM… |
| A0A7R8W887 | 75-651 | TISFPAFATHDERIIAATKTKVVRKLRGHHGFKRFLRDGYGTALEDPSRKYYLQGETKEFENIECEWPMFFAYMLIDGVFRNDRNQV… |
| A0A1I8ILZ9 | 61-575 | None |
| A0A814TIM8 | 14-714 | None |
| A0A183MU10 | 3-717 | None |
| A0A5K3EH41 | 85-1051 | None |
| A0A0B1T8B7 | 46-619 | None |
| A0A1Y1Y6Z0 | 107-884 | None |
| A0A0S7JPL4 | 1-438 | None |
| A0A1I8H7G0 | 99-933 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.