DPCstruct | MC27804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 330 ± 66 aa |
| Standard deviation of domain lengths | 65.60 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8W7H7 | 1-352 | MAGGRRVVTKNVSSRGGGADAVDPHRAGAGGADEYQHWTTSSIPCPKHVPIPHISQDSTLIFEGNMFLFTVLALALQYLHLYRTVWW… |
| A0A2A2LVB6 | 3-354 | QSLLTIIEYAIIKTPLMTLIVSSFLFSFSRVCYDYPRDSIIYFFFPMIIYLFIFYGDLIFWYDRIKDGFSKWFHKQADITVVLERII… |
| A0A4Z2D2W1 | 1-340 | None |
| A0A1X7U0B5 | 21-252 | None |
| A0A044S5S5 | 15-450 | None |
| A0A2H2HZI2 | 2-281 | None |
| J9EJE4 | 1-307 | None |
| A0A7R8X301 | 7-224 | None |
| A0A5N4DAG9 | 49-376 | None |
| A0A3M0J9B9 | 497-871 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.