DPCstruct | MC2780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Standard deviation of domain lengths | 15.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7RG01 | 23-87 | EVHGLPNKIGNREVVGYGYNGEETYLDRVDYPMPAIRFMPSSSDIMALREKEKGDWKKLSLEEKK |
| A0A2G5VSC8 | 1-91 | MLARQMMLPRLALRAIHTTTRVAGGQEFYWGPAKAAGRELVGYGANGDNIYQDRLDYWYPAIRFRKEDSVIAPIRAKEQADWKNLSA… |
| A0A4E0RTA5 | 4-96 | None |
| A0A3P8FGR4 | 3-80 | None |
| A0A1A9V1W7 | 2-103 | None |
| A0A1B0AFL4 | 21-97 | None |
| A0A1A9VNC7 | 1-91 | None |
| A0A820CG56 | 1-134 | None |
| A0A6P7GBQ5 | 1-85 | None |
| A0A821TES6 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.