DPCstruct | MC278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 125 ± 26 aa |
| Standard deviation of domain lengths | 26.20 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A829CMW0 | 3-158 | GQPIPSELKEKGLIWLLPPYCWSHRQIARKLKISASVVSKWRCELVEQGLLPENEKITSVDVEDWTPERRFSVVLETATLSEMELAD… |
| A0A645HAQ7 | 2-127 | VTKMLPPNNQSISRISKQEGIPQATLRKWRDGARANGQAAPATDAPSDDWTTEDKFLIVVETAGMTETDLAEYCRKKGIYAEQIERW… |
| G2E825 | 3-148 | None |
| A0A4R5PZI2 | 1-139 | None |
| A0A645C2E0 | 25-182 | None |
| A0A849T7A9 | 32-184 | None |
| A0A4R1IHZ6 | 1-129 | None |
| A0A6S5YAT9 | 3-139 | None |
| A0A3M5ET47 | 1-84 | None |
| D2Z5R2 | 3-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.