DPCstruct | MC27799
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 155 ± 16 aa |
| Standard deviation of domain lengths | 16.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1JJJ9 | 8-141 | SIRCYCRLGSEDPDMLHCDTCGNWLHTVCCGFFSNKDRRIPRREFSCFYCTRHITKADSADALFRRILSIVYTEGLKNKVWLCHRLG… |
| A0A1I8JG97 | 56-238 | QTVAPLTDNVLFYNVSGWSIIGDDEEEELSVRCPCERDADMGIMIRCEACELWQHAVCFGILRESEAPPVHYCEVCIESKFLCETGN… |
| A0A370TVV1 | 437-586 | None |
| A0A183LF77 | 189-337 | None |
| A0A6G1LYY6 | 394-546 | None |
| A0A6J3BSM9 | 14-171 | None |
| A0A6A5Z9C1 | 309-456 | None |
| A0A183SJE0 | 1-161 | None |
| A0A3P6UK60 | 150-279 | None |
| A0A2P8Y959 | 243-391 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.