DPCstruct | MC27798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HWU2 | 660-759 | MGKQPEPLVGTDIVVFVMPSSSARCAQLPRAADKLPFYVALKKLRDYVVGISSHLNDSDVVFTDYTEMRVTQPDPKSETQGGAGPAQ… |
| A0A1I8JE10 | 1-149 | MGKQPGPLPGTDDIAVFVMPSSSARCAQLPRAADKLPFYIALRKMRDQILGRTGPVPDAELVFTDYTEMRVSQPDPKSVLKAERRRQ… |
| A0A068Y2U9 | 32-190 | None |
| A0A183MA69 | 1-173 | None |
| A0A3P7BVT9 | 83-220 | None |
| A0A183B390 | 27-198 | None |
| A0A2H1CYF8 | 1-172 | None |
| Q9V4D8 | 901-1025 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.