DPCstruct | MC27796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 236 ± 40 aa |
| Standard deviation of domain lengths | 39.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482XGA2 | 3-154 | LKEARSCISLLDRNCHLFVKVLLIQKWPSRSVELVEEYQGFLLDLCSAHSYYTELAINQLTQLFLPDAFEDPEWINGEPTEEDKLAF… |
| A0A1I8J8X1 | 9-242 | CGALSRALDSNPASEKHYNLACHELASGGLTAQRLATEAQAGAVVRYLLALAGRIDPERHAELARLLLTNWPPCRLLDSAGLDRYRR… |
| A0A6P4KU91 | 11-274 | None |
| A0A1X7UDD9 | 33-223 | None |
| A0A821UND5 | 8-233 | None |
| A0A817JWE4 | 8-226 | None |
| A0A7J5Y8A3 | 23-234 | None |
| A0A0B1PG77 | 2-276 | None |
| A0A2K6BWZ9 | 40-287 | None |
| A0A182TM74 | 42-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.