DPCstruct | MC27795
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 135 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8J152 | 1-140 | SSGHGSHSSSSANRRLAKEIIQSVKSSGLFDELRRDCAAKLESRSGYSRLINQLKPLTKKHLDRVVWEPGLNKVATRERLRRRLLDT… |
| A0A7R8UQ35 | 9-124 | LVDKIVNEVKSQGVFDQFRKDSMADVDTKPAYQNLRQRVETSVGKFLADQKWKSDLNKFQLREKLRKYIVEAGFLDTGVERIVDQVV… |
| A0A6P6QUP9 | 9-133 | None |
| H0W883 | 29-168 | None |
| T1FXM7 | 3-126 | None |
| T1JQC3 | 2-125 | None |
| A0A0R4IQX3 | 2-141 | None |
| A0A224Z977 | 15-140 | None |
| A0A0N4V1E5 | 2-160 | None |
| A0A443SUY9 | 6-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.