DPCstruct | MC27792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 63.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820RGI1 | 28-113 | NIRQFNCSPHPYWLPNFMDVFSWSLPFVGEKVIDVLLNILNICTDEELAEYDAHIDTLIERNNREQRKEQIRSKIRALGKVAKAYK |
| A0A6J3K3D4 | 780-864 | NIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMSDGDDGLEEDGAAANLRKEVIRNKIRAIGKMARVFS |
| A0A813WM82 | 366-452 | None |
| A0A3P9HEA2 | 327-411 | None |
| A0A5N4DJY9 | 99-190 | None |
| A0A2A9NPC0 | 146-234 | None |
| A0A5K3EQ99 | 104-195 | None |
| A0A369GQG7 | 747-843 | None |
| T1K363 | 59-146 | None |
| A0A818CLN1 | 43-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.