DPCstruct | MC27787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.13 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M2PG27 | 2-106 | LLQLAEDRRRLKGVQSTVKKAEIKVELLPKYAAWAEGVLAAGGAQQDDVLMYVMLWRIDAGDYAGALEIGRHALRHGWVMPLGNRNV… |
| A0A771B692 | 1-140 | MITPAQQHWQNVMAQRAGRANEGVDHAARTAHEEVLYRLRLAQARLKGVQARSAKAAIKKELLPDFSGWIEGTLEADGGQQDEVIAT… |
| A0A5T7ZCQ5 | 2-107 | None |
| W0HJV2 | 1-136 | None |
| A0A0J7Y416 | 13-138 | None |
| A0A5N8AC52 | 61-215 | None |
| D4DNQ1 | 1-131 | None |
| C0B389 | 364-503 | None |
| A0A418WP22 | 1-152 | None |
| A0A7M1L6U5 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.