DPCstruct | MC27785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10976 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B5KLP8 | 26-84 | MPQLEDYAYGMDLDVGKLVYVSPSVRYCGNVRSMMTYEDSKGELHMVRYLVKGECVNSR |
| A0A5E7H0I3 | 16-84 | NICTLSARAEADVTAKTYSYGTHLDIKKVVSLKQDASNSCGIVDAQLTYLDSQNKTQVLDYRKFADCDS |
| L0GL31 | 24-97 | None |
| A0A839T6X8 | 33-112 | None |
| A0A3M5E0I6 | 58-128 | None |
| A0A7Y8D121 | 16-84 | None |
| A0A5E7M2N2 | 14-82 | None |
| A0A1G8IZ65 | 38-106 | None |
| C1DPH0 | 4-69 | None |
| A0A562I1A1 | 22-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.