DPCstruct | MC27784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 52 ± 4 aa |
| Standard deviation of domain lengths | 3.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 68.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4SS53 | 2-53 | ILGDTCTRSCRICNVKNSFAHPPLNLLEPTNVAEVIAWWGLDYLVITSVDRD |
| A0A183A138 | 1-55 | MIMGDTCTRGCRFCSVKTSPRPPPLDPEEPANTAEAISRWNVDYIVITSVDRDDL |
| A0A0A9DVT5 | 1-44 | None |
| A0A437AXQ3 | 72-126 | None |
| E9JBI8 | 38-89 | None |
| A0A1S4ER22 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.