DPCstruct | MC27783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 149 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9VGV5 | 9-114 | KELTRHKIIEKIGTAAFVLCSSGEHFMGDVVGIVALLGTVTDSKIGRMLAMYLGKEDMLAVVCKTLDAANHIEKYKTDGTVDVGFGI… |
| V4S657 | 3-164 | GLKIKQHEDHIKLLKSQSLKLGDSILDLQVNLGKYHSAKVDNEDHSNHQNEEETTGQILQHEKSAAGVLCQLKTRHCTQASHLTFTK… |
| A0A445CPH1 | 5-213 | None |
| A0A2G3CWS9 | 64-177 | None |
| A0A4Y7J9Q8 | 621-744 | None |
| A0A4Y7LGZ6 | 125-293 | None |
| A0A3Q7FN09 | 375-590 | None |
| A0A540K8L6 | 988-1148 | None |
| A0A1S3YQQ7 | 911-1068 | None |
| A0A843UG44 | 388-589 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.