DPCstruct | MC27782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B9V3H2 | 80-156 | EWRDYFCPDSRQRIVYKIMKLLKRHLDVTDPEGSQELWRIAERLEEKIFSKADTETDYLRKITIKMHKMENTPRRSH |
| V4S091 | 14-109 | TLKKPSSPKNEDAGLDESDWRTQLGRGARQRVVNRILVTLKRHVPFSGEERLRELMKIAARFEAKNYAIAMSESDYRQRISLKMHQL… |
| A0A6P6FT26 | 1-90 | None |
| A0A5N6PIE2 | 7-125 | None |
| A0A1U8F3R4 | 72-175 | None |
| A0A2G3CRR3 | 88-188 | None |
| A0A5E4EZ40 | 1-94 | None |
| A0A5E4EYL5 | 86-195 | None |
| A0A5E4ESR2 | 8-115 | None |
| A0A0D3H2B1 | 52-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.