DPCstruct | MC27780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 187 ± 31 aa |
| Standard deviation of domain lengths | 31.09 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.47 |
| Pfam Score | 71.99 |
| Assigned Pfam label(s) | CL0023- CL0465- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402ATU7 | 320-493 | DVMDEAGSALVLEASDKGLVNPSILEKELADLQQQKEAAAEAEDYEKAAQLRQQELLTLQKLEKARSESETTFSLLVTPEQIAQVVE… |
| A0A6A0B760 | 170-370 | DIETIEVLKSRVKQYERDYDVSIDEQLLKEIVANTSRYMPADAQPRKSIGMLDSLVGYYREFHEPISHKTLAKMFKDSIGVNIDFKI… |
| A0A654GKB9 | 398-595 | None |
| A0A7R9T1U9 | 1-170 | None |
| A0A1Q6TNY7 | 260-454 | None |
| A0A7J6PFZ0 | 477-657 | None |
| A0A6G3AUH1 | 2-117 | None |
| A0A229Y375 | 367-571 | None |
| A0A835YDQ4 | 693-914 | None |
| A0A2D6PR22 | 53-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.