DPCstruct | MC27779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 224 ± 41 aa |
| Standard deviation of domain lengths | 40.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0129- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6P7T7 | 10-204 | PEMFYSLVMFFSLGCFIYLGKKWKIPKHFILLHSTIVGWSGLMYLFIAYQTSIADLARYFDWVVSTPLLLMALYFTAILNKKGNYSI… |
| A0A402ATH3 | 3-224 | PITTTLWIGTAIMVLGLLAFLALMVKAPAANRSFFSATSLVALIAATSYFAMATGHGSVLIGGRVFFFARYIDWVFTTPLLLLDLAL… |
| A0A6I2Z3J5 | 9-170 | None |
| B5VE19 | 2-187 | None |
| A0A7C3GW70 | 51-267 | None |
| A0A0G4HDQ8 | 60-301 | None |
| A0A0G4GWU5 | 31-313 | None |
| A0A6N8FSK0 | 14-273 | None |
| A0A2G7GLF2 | 15-196 | None |
| A0A7S4PI43 | 6-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.