DPCstruct | MC27777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5ZFM5 | 65-137 | GLPMLGQEGQVLHIHSHLDVYVDGKAVTVPALVGIDESAQQISPLHTHDTSGVVHIESPVKRDFTLGEFMTEW |
| A0A402AQE5 | 2-78 | NGISCDASEQLAYHIHAHLSMYINGQPVQVPQNVGIASDQSCIYWLHTHDTSGIIHIESPTQKTYTLGNFTQLWGSV |
| A0A2S1FII6 | 2-87 | None |
| A0A7G5Z936 | 133-201 | None |
| A0A2E3S4U0 | 204-297 | None |
| A0A535SJW2 | 1-78 | None |
| A0A0K2RPA1 | 15-92 | None |
| A0A257RUE4 | 5-93 | None |
| A0A1P9Y7Y1 | 169-242 | None |
| A0A7C4TAT6 | 17-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.