DPCstruct | MC27775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 181 |
|---|---|
| Mean domain length (aa) | 330 ± 60 aa |
| Standard deviation of domain lengths | 59.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 13.84 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0698- CL0690 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497SB95 | 4-345 | IIIGITLTVLALSGIASSGWVEDQIIKIPEHFARFILDMMIHHIKGMLVWVKDMLMWNPDPDDIKPIVDDSIEILIPIYVMIITLTG… |
| A0A402ANY4 | 111-387 | IHYCDAFVGFMQWIADSFNNGANWLIAQSQHMTERIPPDATYGNPAVIAVWQVMVHITDGLVIVAFCWIGLRLLTAGSRAVSYADVV… |
| A0A1A8Z9X1 | 113-462 | None |
| A0A0F9ZFL2 | 81-409 | None |
| A0A542ZAV1 | 3-298 | None |
| A0A0G1KWS2 | 97-354 | None |
| B1I0C4 | 129-417 | None |
| A0A3S0CWA2 | 14-384 | None |
| A0A417DM42 | 6-291 | None |
| A0A1Y4HAD7 | 17-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.