DPCstruct | MC27774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 147 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.19 |
| Pfam Score | 96.78 |
| Assigned Pfam label(s) | PF02142- CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9IVI0 | 509-641 | ALKAFTHTSEYDLAISDYFRKQYSAGVSQLTLRYGMNPHQKPAQIFTTLQKLPLKVVNGSPGFINLCDALNGWQLVKELKAALGLPA… |
| A0A402AGM9 | 2-163 | LQEWREQGEISLETRRHLAAIAFQHTACYDTAVAEYLRGPTGERFPEEMTIPLERLHVLRYGENPHQHAAFYRWADSTSCSSNLPTI… |
| W7YY67 | 92-266 | None |
| A0A0D8XZ16 | 6-153 | None |
| A0A377ZSU8 | 48-191 | None |
| A0A7V1K4M8 | 1-113 | None |
| S9S8F7 | 159-311 | None |
| A0A835GX96 | 229-373 | None |
| A0A2M7RD15 | 38-190 | None |
| A0A4S4EWH4 | 226-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.