DPCstruct | MC27771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318WZD3 | 1-85 | MLATSRAPLRVRAERERPLGPLPLPAGSSAGAVAASPAAQVFLDRAAAAGRPGALTDATAADVAAICRRLDGLPLALELAAAHAR |
| A0A6P2BZ04 | 1-87 | MRLLATSRVPLHAAGEHTLLISPLEVPADDAAAGYSEAAALFADRARAAVPDFELTPRNTPAVAELCRRLDGIPLALELHLEHIFGK |
| A0A3T1B4H5 | 40-168 | None |
| A0A3D1U0Z2 | 8-107 | None |
| A0A1V3WMY7 | 1-83 | None |
| A0A1B1K6I2 | 85-172 | None |
| A0A6B1JJP2 | 40-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.