DPCstruct | MC2777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M6JY28 | 20-93 | MEIVCPVCNGLTPVEAFCPQCGEPMLDGGPVEDYLGSYSPYMEKGTCQEQNYCIHLLYCPDCHYDVRAAWEMII |
| A0A2A6DY77 | 2-83 | RASICSVCNGLRPLHAVCPACGAEAVDSGRADEYWGPYAPYLPIDDLKMTNGLPDLARRECAHLARCPRCGTVSTVFVRERA |
| A0A3G1KN39 | 1-79 | None |
| A0A2N0QL37 | 110-189 | None |
| A0A1M5SRB6 | 33-108 | None |
| A0A6N7ISA9 | 2-69 | None |
| A0A7X7AFL1 | 10-72 | None |
| A0A516KE69 | 3-72 | None |
| A0A1X7FGR6 | 1-71 | None |
| A0A1H5ZQG7 | 15-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.