DPCstruct | MC27763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 219 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7W375 | 32-275 | FGGIRSGMRTGALEHYDDPGTMAILQQIAGCAVTSGFMRRPDMSALLNGLRANLPPPRGPGAGTSAGVPGVFGAPPLPSGLCPRDYP… |
| A0A3L6NXF9 | 25-239 | QALEAYVSARNWGDRKLFLDWTAQWGHVQQCPRKNFSKNRRWWGWGVLEICEDCYASFAKGTALEPRFALTGVREPEKERMCDIYSP… |
| A0A2T7A6E5 | 928-1140 | None |
| A0A1Y1ZVB7 | 233-486 | None |
| N1RS34 | 583-797 | None |
| W9VVR1 | 44-279 | None |
| A0A194XDX1 | 222-434 | None |
| A0A545UN94 | 358-570 | None |
| A0A6A6P8T0 | 207-437 | None |
| A0A177DQN8 | 126-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.