DPCstruct | MC27762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 200 ± 42 aa |
| Standard deviation of domain lengths | 42.25 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.81 |
| Pfam Score | 96.31 |
| Assigned Pfam label(s) | CL0172- PF04161- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0V6G8 | 6-234 | ICVQCGDSVEELFHKYSATVLKLAHCKHCGQIADSYVEYEPAFLLLDLFLQRLPAYRHMLFNMKTMAKFHKNKWIYTSRQVVLFMLC… |
| F7VNB6 | 2-190 | PICIECRHPVKTLWREGAGDKSTGHNIRLTVCKNCGRFCDKYVEHDFVVLFIDLVLIKPQVYRHLLHNTLMKDEDEFAPSIIRLGVL… |
| A0A438NE85 | 2-269 | None |
| A0A5S6QTD4 | 420-630 | None |
| A0A060RSW5 | 2-127 | None |
| A0A1D2N0H1 | 48-275 | None |
| G8BAX7 | 2-226 | None |
| A0A1Y2DUZ4 | 639-897 | None |
| A0A2P8Y0C0 | 2-218 | None |
| A0A151I0Z4 | 2-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.