DPCstruct | MC27761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 105 ± 17 aa |
| Standard deviation of domain lengths | 17.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.89 |
| Pfam Score | 95.48 |
| Assigned Pfam label(s) | CL0344- PF00420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1RPP4 | 5-101 | VTPYLTLGAVLFCIGLYGALTKKSAVIVLLSIEIMLNAVNLNLIAFSRLGVNPSITGQIFSLFNITVAAAEAAVGIAILIALYRNKG… |
| A0A256ICL2 | 19-142 | TRHAYVVFALLLCIGLYMMIANPNLVKKVIGLNLFQTAIFLLFIASAYVDGGAIPIVPSGGGTGPYVSPLPHVLVLTAIVVGVSLTA… |
| A0A445D565 | 300-398 | None |
| A0A7V3ACI8 | 32-146 | None |
| A0A6B0GHR1 | 22-136 | None |
| A0A377BU79 | 99-189 | None |
| A0A1C4AND5 | 2-98 | None |
| A0A535YX66 | 90-189 | None |
| A0A2E8A6W8 | 1-157 | None |
| A0A7C4H8R7 | 2-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.