DPCstruct | MC27760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6EZ04 | 145-231 | EWVRTHDNLATAGEQQLEFVYIASACARMNLLDFFDKWGFLTPVDATIDDYGTGQLTVTQQMIDRIRSRVEALGYDAPTAAIEYITD |
| X0VFE6 | 1-91 | MEEMRRRPDAGHGNDSIKNQFEFVKISCDVAKLDLTDFFDKWGFFWVGTMTVHDYRKYHYKITQEMVDDTKSYIAKKKYKKPTVDIT… |
| A0A1M3MER5 | 565-651 | None |
| A0A654BBC8 | 1-97 | None |
| U2HHN0 | 103-190 | None |
| A0A0B7HJW0 | 322-410 | None |
| I9PPY2 | 705-791 | None |
| A0A645H217 | 2-72 | None |
| A0A5C6XXA4 | 6-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.