DPCstruct | MC2776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377XQJ9 | 2-121 | EKHLLISKGCKGWGGPLTITLGQGKKIAYITGGIRPPVVDRLSELTGWPSIDVFKNGEPPAEEIGLMVIDCGGTLRCGLYPKRGIPT… |
| A0A1M6H257 | 3-124 | NYRSIVVKSSNGGFGGPLTITPTEKQHKIMYLIAGGDRPEVVDKICELTGMEAVNGFRYRVQEEEMAVAVIDCGGSLRSGVYPRKGI… |
| R2XH40 | 2-122 | None |
| E2SMN4 | 28-173 | None |
| A0A2X1QSL1 | 188-311 | None |
| A0A7C5E396 | 35-159 | None |
| A0A377YFP6 | 2-123 | None |
| A0A2X3F262 | 271-393 | None |
| A0A5D4NC88 | 160-284 | None |
| A0A7V8IJB7 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.