DPCstruct | MC27757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 140 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0USD8 | 5-146 | DKLMELRQSNAISSFSNSLFLIAYYNKYDLSIENLMPIFDRMSGLNKRYFREDRQQFQDLLSETLTERFTDDSFPFANNYDVGEITC… |
| A0A7V8A2D5 | 195-324 | DIDTLSDNAFLALKFSFNHYLTPKDIMKIHKLVNFTNTRYIKNEAELFQNILSKKIKEDFNSEYYIIKIKNEHSLGTVGAFLLGNIS… |
| A0A1I2HSU6 | 175-323 | None |
| A0A064AKJ9 | 194-333 | None |
| A0A7C7E2D9 | 4-149 | None |
| A0A0G1WEE3 | 2-125 | None |
| A0A417HNW0 | 425-550 | None |
| A0A1F1E5G3 | 320-464 | None |
| A0A2M8GMJ7 | 87-223 | None |
| A0A2H0KMK9 | 295-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.