DPCstruct | MC27755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 53 ± 14 aa |
| Standard deviation of domain lengths | 13.51 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 90.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 65.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XUG2 | 35-82 | RRELALHPEVWELVEVVMDLGRRPLARFPSGDWVISDQPVTADDLRQA |
| A0A835UIQ5 | 85-132 | RRRVEGHSELRYLVEVVMDLGRSPLARFPSGDFVLSERAITDEDIQYA |
| A0A1U8A496 | 19-109 | None |
| A0A835FCK4 | 177-224 | None |
| A0A6A6L6A1 | 533-580 | None |
| A0A2P2L3P2 | 82-129 | None |
| W9SNI8 | 85-132 | None |
| A0A484LRC5 | 88-135 | None |
| A0A444XUV4 | 116-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.