DPCstruct | MC27754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 107 |
|---|---|
| Mean domain length (aa) | 476 ± 100 aa |
| Standard deviation of domain lengths | 99.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 15.77 |
| Pfam Score | 59.48 |
| Assigned Pfam label(s) | PF11443- PF05731- PF16050- PF19334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813UA74 | 128-682 | IDPKPYFTNSGVTIDHHIEAQNKNLSRYLAALFALDINSVEVLQKSKACALAAAWCRHDHKLANNLLRHRRLFTLTEVLKAVNMLDA… |
| A0A803MU98 | 49-501 | KLICNLRGVRGTGKSDKEGFYTAALWLHENHPKTLALNMGPISGFGYLKDMPEILFRLLEGSNTRKPKEDVSSFPYRYELLKKDIEF… |
| A0A7N2L4W5 | 116-639 | None |
| A0A3R7LM57 | 25-652 | None |
| K1Q171 | 264-755 | None |
| T1PJ88 | 6-569 | None |
| A0A565CKT9 | 5-374 | None |
| A0A813M443 | 172-732 | None |
| A0A7S1GEJ9 | 27-649 | None |
| A0A3S3Q3U2 | 79-623 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.