DPCstruct | MC27753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 188 ± 14 aa |
| Standard deviation of domain lengths | 13.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 49.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I4ESG1 | 138-326 | AVLHAASVACSLYLLMAFISHDWLDIAHVLLDHPKVDVFMDAAFDVVKRDIVLLQVKLRSLSIKLSAKKTTFESAERVAQVTALQCE… |
| A0A803MSE1 | 1-195 | MPLLYSALVACIMYLLTACISSQWSELAYVLQAHPKADIFIDVAFGAVRMNINFLQIKLSADENEFHSNSSLGAEKAVNFCCQQCEA… |
| A0A453DKL0 | 86-273 | None |
| A0A251T301 | 18-198 | None |
| A0A7C9EEY9 | 1-168 | None |
| A0A251T229 | 1-211 | None |
| A0A6S7L7I0 | 167-365 | None |
| A0A270R536 | 2-166 | None |
| A0A484LQG5 | 174-374 | None |
| A0A5A7ST93 | 146-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.