DPCstruct | MC27748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5HFF6 | 15-85 | LCNPVLQARLMNEHGTGLNVIIGLCVGHDSLFTKHSDAPVTTLIVKDRVLGHNPAAALYTSGSYYKRLMES |
| A0A662I2B2 | 99-176 | KDKLRPGSFEAICNPVLQALILNKLKTELNVTIGLCVGHDAVFTKLSKAPVVCLIAKDRVTGHNPAAALYVNYLRKRL |
| A0A0K8JCM1 | 43-123 | None |
| A0A0S8A8T2 | 235-325 | None |
| A0A3B9SND6 | 264-332 | None |
| A0A846NM15 | 158-249 | None |
| G7V7Z8 | 51-131 | None |
| G1UTS2 | 138-227 | None |
| A0A117LKP2 | 110-206 | None |
| W7Y0T0 | 79-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.