DPCstruct | MC27747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 223 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6RH50 | 1-205 | MTRRVAVRAPTAASLPDSFRIPSTTFSLVKALGKLSRSSLLDLVIQWLDDKDVKAFPPYLGPRSVVNFVAEEEGLTAYPLAASVEEL… |
| A0A093VUC3 | 1-209 | MAKKRTIRAPTTSSLPNNLRIPSDTPSLVKALGRLSRQSLLDLIFVWLSPKNVELYPPFLNQNSDDNNVPDQDESPYPAAGSVEEIR… |
| J3PBD1 | 77-325 | None |
| Q2GV03 | 1-217 | None |
| A0A6G1HSZ6 | 4-230 | None |
| A0A0N1H8H0 | 1-220 | None |
| A0A5N5DAL2 | 1-265 | None |
| A0A1Z8JN88 | 2-207 | None |
| A0A0P1B826 | 12-231 | None |
| A0A364KKG8 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.