DPCstruct | MC27746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 254 ± 32 aa |
| Standard deviation of domain lengths | 31.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0NLP5 | 176-411 | HPNDLDYEAVARDVNEESYLQFKAVRFEDWVHYSLGYPTPSVEWFLVQHSKLSSYLVDHFNEFPDRSHKYVEVEKHLRSRSPFAHQA… |
| A6RBZ8 | 13-272 | LEKRSEDIARIQLPIGNPLQGVDIQDVSAVTRAIDNYSWSLFQHVPFAAWVRKALGEEVDLIDSFLLHHDIIAVRLYYRLQRCSDKE… |
| A0A0U5CC09 | 107-400 | None |
| I8IVN2 | 36-303 | None |
| A0A1V6X7P2 | 34-328 | None |
| A0A2B7Z433 | 63-294 | None |
| A0A2T5M032 | 133-379 | None |
| A0A5N6TNB6 | 2-211 | None |
| D4DEK5 | 74-288 | None |
| A0A179U7D8 | 38-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.