DPCstruct | MC27743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 165 ± 33 aa |
| Standard deviation of domain lengths | 32.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G2R5V8 | 8-122 | ISGPDVVDAARELPKSTKHIQNLLRFSIERDVVLQPNPKKKGGYRSINWKRPTNIEALLMHVTGVEPEVECNYCNKNQGPFMNCIVS… |
| A6R6S8 | 26-190 | KDNRGALSLLGLSGPQSPHRILFVADQQLSPFTHSPQSRAVLALPGQDVPFVRGSMTELQVRSHRPSYINAILIQSRGRTEPHACLA… |
| A0A101MAL6 | 21-182 | None |
| A0A117NRY9 | 3-160 | None |
| A0A1V6NRA3 | 13-139 | None |
| A0A6A5V1I5 | 2-149 | None |
| A0A1V6REM4 | 75-293 | None |
| A0A3N4KGZ0 | 165-339 | None |
| A0A318Z299 | 6-215 | None |
| A0A1L9VSI5 | 16-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.