DPCstruct | MC27740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A093Z2A0 | 130-216 | CDCDPTITWTTPAKAKPTTPPENTVAIIVDVRINKGAIRIFQKSGSEYLDGIGTEQAGNLVIVPWSSAWYISAAGSLPVGYVAKRGV |
| A6R0B6 | 1-101 | MVCKVKDLKTNKETIRDDISDPDWQPLANNVRTKPPENTVFVVIDVRDKQGAIFVHESGTDEYVGGVGTDEQGNVVMIPWNHNWYYY… |
| W9NCJ4 | 27-102 | None |
| A0A2T4B2H0 | 25-117 | None |
| A0A229XW98 | 1-68 | None |
| C5FZS2 | 1-100 | None |
| A0A0D1ZX01 | 53-135 | None |
| A0A5Q4BKS5 | 5-92 | None |
| A6R4Q2 | 4-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.